Structure of porcine insulin cocrystallized with clupeine z
PDB DOI: 10.2210/pdb7ins/pdb
Classification: HORMONE Organism(s): Sus Scrofa , Synthetic Construct
Deposited: 1991-09-03 Deposition Author(s): Balschmidt, P. , Dodson, E. , Dodson, G. , Hansen, F.B. , Korber, F.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Structure of porcine insulin cocrystallized with clupeine z
Balschmidt, P. , Dodson, E. , Dodson, G. , Hansen, F.B. , Korber, F.
Primary Citation of Related Structures: 7INS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| INSULIN (CHAIN A) | A | 21 | Sus Scrofa , Synthetic Construct | GIVEQCCTSICSLYQLENYCN |
| INSULIN (CHAIN A) | C | 21 | Sus Scrofa , Synthetic Construct | GIVEQCCTSICSLYQLENYCN |
| INSULIN (CHAIN A) | E | 21 | Sus Scrofa , Synthetic Construct | GIVEQCCTSICSLYQLENYCN |
| INSULIN (CHAIN B) | B | 30 | Sus Scrofa , Synthetic Construct | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
| INSULIN (CHAIN B) | D | 30 | Sus Scrofa , Synthetic Construct | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
| INSULIN (CHAIN B) | F | 30 | Sus Scrofa , Synthetic Construct | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
| GENERAL PROTAMINE CHAIN | G | 16 | Sus Scrofa , Synthetic Construct | XXXXXXXXXXXXXXXX |
Method: X-RAY DIFFRACTION
Deposited Date: 1991-09-03 Deposition Author(s): Balschmidt, P. , Dodson, E. , Dodson, G. , Hansen, F.B. , Korber, F.