Group deposition for crystallographic fragment screening of chikungunya virus nsp3 macrodomain -- crystal structure of chikungunya virus nsp3 macrodomain in complex with z432057220 (chikv_macb-x0732)
PDB DOI: 10.2210/pdb7h7e/pdb
Classification: VIRAL PROTEIN Organism(s): Chikungunya Virus
Deposited: 2024-04-26 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Capkin, E. , Chandran, A.V. , Dolci, I. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Golding, M. , Koekemoer, L. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Oliva, G. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Wild, C. , Winokan, M. , Xavier, M.-A.E.
Group deposition for crystallographic fragment screening of chikungunya virus nsp3 macrodomain -- crystal structure of chikungunya virus nsp3 macrodomain in complex with z432057220 (chikv_macb-x0732)
Aschenbrenner, J.C. , Balcomb, B.H. , Capkin, E. , Chandran, A.V. , Dolci, I. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Golding, M. , Koekemoer, L. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Oliva, G. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Wild, C. , Winokan, M. , Xavier, M.-A.E.
Primary Citation of Related Structures: 7H7E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Non-structural protein 3 | A | 163 | Chikungunya Virus | GAMAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYTESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT |
| Non-structural protein 3 | B | 163 | Chikungunya Virus | GAMAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYTESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT |
| Non-structural protein 3 | C | 163 | Chikungunya Virus | GAMAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYTESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT |
| Non-structural protein 3 | D | 163 | Chikungunya Virus | GAMAPSYRVKRMDIAKNDEECVVNAANPRGLPGDGVCKAVYKKWPESFKNSATPVGTAKTVMCGTYPVIHAVGPNFSNYTESEGDRELAAAYREVAKEVTRLGVNSVAIPLLSTGVYSGGKDRLTQSLNHLFTAMDSTDADVVIYCRDKEWEKKISEAIQMRT |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-26 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Capkin, E. , Chandran, A.V. , Dolci, I. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Golding, M. , Koekemoer, L. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Oliva, G. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Wild, C. , Winokan, M. , Xavier, M.-A.E.