The crystal structure of peptidoglycan peptidase in complex with inhibitor 2
PDB DOI: 10.2210/pdb7e61/pdb
Classification: HYDROLASE/INHIBITOR Organism(s): Campylobacter Jejuni
Deposited: 2021-02-21 Deposition Author(s): Choi, Y. , Lee, H.H. , Min, K.J. , Yoon, H.J.
The crystal structure of peptidoglycan peptidase in complex with inhibitor 2
Choi, Y. , Lee, H.H. , Min, K.J. , Yoon, H.J.
Primary Citation of Related Structures: 7E61
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidase M23 | A | 255 | Campylobacter Jejuni | MELIKGQALFLELDKKDFLSLKNNDKNIPTFAHPKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSEKLQVENKKIFPPKTIQERIAKELKEANAIYSSYTPKALFNGAFNIPLNSFITSDFGKARTFNEKVASYHSGTDFRAATGTPIYAANSGVVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPALHFGILAGGKQVDPLDFVSKFNAIFQL |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-02-21 Deposition Author(s): Choi, Y. , Lee, H.H. , Min, K.J. , Yoon, H.J.