X-ray crystal structure of vapb12 antitoxin from mycobacterium tuberculosis in space group p41.
PDB DOI: 10.2210/pdb7e4j/pdb
Classification: ANTITOXIN Organism(s): Mycobacterium Tuberculosis
Deposited: 2021-02-13 Deposition Author(s): Chandresh, S. , Krishnan, V. , Megta, A.K. , Pandey, A.K. , Pratap, S. , Talwar, S.
X-ray crystal structure of vapb12 antitoxin from mycobacterium tuberculosis in space group p41.
Chandresh, S. , Krishnan, V. , Megta, A.K. , Pandey, A.K. , Pratap, S. , Talwar, S.
Primary Citation of Related Structures: 7E4J
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Antitoxin | A | 44 | Mycobacterium Tuberculosis | MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP |
Antitoxin | B | 44 | Mycobacterium Tuberculosis | MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP |
Antitoxin | C | 44 | Mycobacterium Tuberculosis | MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP |
Antitoxin | D | 44 | Mycobacterium Tuberculosis | MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-02-13 Deposition Author(s): Chandresh, S. , Krishnan, V. , Megta, A.K. , Pandey, A.K. , Pratap, S. , Talwar, S.