X-ray structure of a gb1:t2q/d46k mutant
PDB DOI: 10.2210/pdb7da8/pdb
Classification: PROTEIN BINDING Organism(s): Streptococcus Sp. Group G
Deposited: 2020-10-15 Deposition Author(s): Gosavi, S. , Manjula, R. , Ramaswamy, S.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
X-ray structure of a gb1:t2q/d46k mutant
Gosavi, S. , Manjula, R. , Ramaswamy, S.
Primary Citation of Related Structures: 7DA8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G | A | 62 | Streptococcus Sp. Group G | MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYKDATKTFTVTEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-10-15 Deposition Author(s): Gosavi, S. , Manjula, R. , Ramaswamy, S.