Simplified alpha-carboxysome, t=3
PDB DOI: 10.2210/pdb7ckb/pdb
Classification: VIRUS LIKE PARTICLE Organism(s): Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2)
Deposited: 2020-07-16 Deposition Author(s): Ali, S. , Narita, A. , Robinson, R.C. , Tan, Y.Q. , Xue, B. , Yew, W.S.
Method: ELECTRON MICROSCOPY Resolution: 3.24 Å
Simplified alpha-carboxysome, t=3
Ali, S. , Narita, A. , Robinson, R.C. , Tan, Y.Q. , Xue, B. , Yew, W.S.
Primary Citation of Related Structures: 7CKB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Unidentified carboxysome polypeptide | AA | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AB | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AC | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AD | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AE | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AF | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AG | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AH | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AI | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AJ | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AK | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AL | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AM | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AN | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AO | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AP | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AQ | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AR | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AS | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AT | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AV | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AW | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AX | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AY | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | AZ | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A0 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A1 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A2 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A3 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A4 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A5 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A6 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A7 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A8 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Unidentified carboxysome polypeptide | A9 | 94 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGEGSSWSHPQFEK |
| Major carboxysome shell protein 1A | BA | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CA | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BB | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CB | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BC | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CC | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BD | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CD | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BE | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CE | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BF | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CF | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BG | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CG | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BH | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CH | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BI | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CI | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BJ | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CJ | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BK | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CK | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BL | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CL | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BM | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CM | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BN | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CN | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BO | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CO | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BP | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CP | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BQ | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CQ | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BR | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CR | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BS | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CS | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BT | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CT | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BV | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CV | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BW | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CW | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BX | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CX | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BY | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CY | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | BZ | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | CZ | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B0 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C0 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B1 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C1 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B2 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C2 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B3 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C3 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B4 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C4 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B5 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C5 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B6 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C6 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B7 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C7 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B8 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C8 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | B9 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
| Major carboxysome shell protein 1A | C9 | 98 | Halothiobacillus Neapolitanus , Halothiobacillus Neapolitanus (Strain Atcc 23641 / C2) | MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA |
Method: ELECTRON MICROSCOPY
Deposited Date: 2020-07-16 Deposition Author(s): Ali, S. , Narita, A. , Robinson, R.C. , Tan, Y.Q. , Xue, B. , Yew, W.S.