Crystal structure of arabidopsis aipp3 bah domain in complex with an h3k27me3 peptide
PDB DOI: 10.2210/pdb7cce/pdb
Classification: GENE REGULATION Organism(s): Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-06-17 Deposition Author(s): Du, J. , Yuan, J.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromo-adjacent homology (BAH) domain-containing protein | A | 169 | Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGKGKGKRTHFNQFAYDGNTYDLEVPVLLVPEDKSQKPYVAIIKDITQTKDGSMMILGQWFYRPEEAEKRGGGNWQSSDTRELFYSFHRDEVPAESVMHRCVVYFVPAHKQLPKRKNNPGFIVRKVYDTVEKKLWKLTDKDYEDSKQREIDVLVKKTMNVLGDLPDLES |
Histone H3.2 | P | 18 | Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LATKAARKSAPATGGVKK |
Method: X-RAY DIFFRACTION