Structure of foxg1 dna binding domain bound to dbe2 dna site
PDB DOI: 10.2210/pdb7cby/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-06-15 Deposition Author(s): Chen, Y.H. , Dai, S.Y. , Li, J.
Structure of foxg1 dna binding domain bound to dbe2 dna site
Chen, Y.H. , Dai, S.Y. , Li, J.
Primary Citation of Related Structures: 7CBY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Forkhead box protein G1 | C | 106 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSR |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-06-15 Deposition Author(s): Chen, Y.H. , Dai, S.Y. , Li, J.