Solution structure of the orange domain from human protein hes1
PDB DOI: 10.2210/pdb7c4o/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2020-05-18 Deposition Author(s): Fan, J.S. , Nayak, A. , Swaminathan, K.
Solution structure of the orange domain from human protein hes1
Fan, J.S. , Nayak, A. , Swaminathan, K.
Primary Citation of Related Structures: 7C4O
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor HES-1 | A | 48 | Salmonella Enterica | DPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQI |
Transcription factor HES-1 | B | 48 | Salmonella Enterica | DPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQI |
Method: SOLUTION NMR
Deposited Date: 2020-05-18 Deposition Author(s): Fan, J.S. , Nayak, A. , Swaminathan, K.