Complex structure of tyrosinated alpha-tubulin carboxy-terminal peptide and a1ay1 binder
PDB DOI: 10.2210/pdb7c1m/pdb
Classification: PROTEIN BINDING Organism(s): Saccharolobus Solfataricus 98/2 , Synthetic Construct
Deposited: 2020-05-05 Deposition Author(s): Das, R. , Kesarwani, S. , Reddy, P.P. , Sirajuddin, M.
Complex structure of tyrosinated alpha-tubulin carboxy-terminal peptide and a1ay1 binder
Das, R. , Kesarwani, S. , Reddy, P.P. , Sirajuddin, M.
Primary Citation of Related Structures: 7C1M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nanobody binder from SSO7d library | A | 67 | Saccharolobus Solfataricus 98/2 , Synthetic Construct | GSHMATVKFKYKGEEKQVDISKILSVGRYGKLIHFLYDLGGGKAGMGMVSEKDAPKELLQMLEKQKK |
| Carboxy-terminal peptide from tyrosinated alpha-tubulin | B | 12 | Saccharolobus Solfataricus 98/2 , Synthetic Construct | VEGEGEEEGEEY |
Method: SOLUTION NMR
Deposited Date: 2020-05-05 Deposition Author(s): Das, R. , Kesarwani, S. , Reddy, P.P. , Sirajuddin, M.