Crystal structure of chimeric mutant of gh5 in complex with z-dna
PDB DOI: 10.2210/pdb7c0j/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Gallus Gallus , Homo Sapiens , Synthetic Construct
Deposited: 2020-05-01 Deposition Author(s): Choi, H.J. , Park, C.H.
Crystal structure of chimeric mutant of gh5 in complex with z-dna
Primary Citation of Related Structures: 7C0J
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Histone H5,Double-stranded RNA-specific adenosine deaminase | A | 76 | Gallus Gallus , Homo Sapiens , Synthetic Construct | GSHMASHPTYSEMIAAAIRAEGEGGGSSRQSIQAYIKSHYKVGHNKKEINRVLYSLLAAGVLKQTKGVPGSWALAK |
Histone H5,Double-stranded RNA-specific adenosine deaminase | B | 76 | Gallus Gallus , Homo Sapiens , Synthetic Construct | GSHMASHPTYSEMIAAAIRAEGEGGGSSRQSIQAYIKSHYKVGHNKKEINRVLYSLLAAGVLKQTKGVPGSWALAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-01 Deposition Author(s): Choi, H.J. , Park, C.H.