Crystal structure of pafb in complex with zinc
PDB DOI: 10.2210/pdb7baf/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Penicillium Rubens (Strain Atcc 28089 / Dsm 1075 / Nrrl 1951 / Wisconsin 54-1255)
Deposited: 2020-12-15 Deposition Author(s): Alex, J.M. , Crowley, P.B. , Guagnini, F. , Huber, A. , Marx, F.
Crystal structure of pafb in complex with zinc
Alex, J.M. , Crowley, P.B. , Guagnini, F. , Huber, A. , Marx, F.
Primary Citation of Related Structures: 7BAF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Antifungal protein | A | 58 | Penicillium Rubens (Strain Atcc 28089 / Dsm 1075 / Nrrl 1951 / Wisconsin 54-1255) | LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-12-15 Deposition Author(s): Alex, J.M. , Crowley, P.B. , Guagnini, F. , Huber, A. , Marx, F.