Solution structure of the pax nrps docking domain paxb ndd
PDB DOI: 10.2210/pdb7b2f/pdb
Classification: PROTEIN BINDING Organism(s): Xenorhabdus Cabanillasii Jm26
Deposited: 2020-11-26 Deposition Author(s): Bode, H.B. , Duchardt-Ferner, E. , Sarawi, S. , Watzel, J. , Woehnert, J.
Solution structure of the pax nrps docking domain paxb ndd
Bode, H.B. , Duchardt-Ferner, E. , Sarawi, S. , Watzel, J. , Woehnert, J.
Primary Citation of Related Structures: 7B2F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptide synthetase XpsB (Modular protein) | A | 31 | Xenorhabdus Cabanillasii Jm26 | MNNNELTSLPLAERKRLLELAKAAKLSRQHY |
Method: SOLUTION NMR
Deposited Date: 2020-11-26 Deposition Author(s): Bode, H.B. , Duchardt-Ferner, E. , Sarawi, S. , Watzel, J. , Woehnert, J.