Ccaat-binding complex and hapx bound to aspergillus nidulans ccca dna
PDB DOI: 10.2210/pdb7aw7/pdb
Classification: TRANSCRIPTION Organism(s): Aspergillus Nidulans Fgsc A4 , Emericella Nidulans (Strain Fgsc A4 / Atcc 38163 / Cbs 112.46 / Nrrl 194 / M139) , Synthetic Construct
Deposited: 2020-11-06 Deposition Author(s): Groll, M. , Huber, E.M.
Ccaat-binding complex and hapx bound to aspergillus nidulans ccca dna
Primary Citation of Related Structures: 7AW7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HapB | A | 64 | Aspergillus Nidulans Fgsc A4 , Emericella Nidulans (Strain Fgsc A4 / Atcc 38163 / Cbs 112.46 / Nrrl 194 / M139) , Synthetic Construct | MESPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLTADE |
| Transcription factor HapC (Eurofung) | B | 92 | Aspergillus Nidulans Fgsc A4 , Emericella Nidulans (Strain Fgsc A4 / Atcc 38163 / Cbs 112.46 / Nrrl 194 / M139) , Synthetic Construct | MKEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE |
| CBFD_NFYB_HMF domain-containing protein | C | 119 | Aspergillus Nidulans Fgsc A4 , Emericella Nidulans (Strain Fgsc A4 / Atcc 38163 / Cbs 112.46 / Nrrl 194 / M139) , Synthetic Construct | MGTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVPR |
| BZIP domain-containing protein | D | 98 | Aspergillus Nidulans Fgsc A4 , Emericella Nidulans (Strain Fgsc A4 / Atcc 38163 / Cbs 112.46 / Nrrl 194 / M139) , Synthetic Construct | GSVTSKEWIIPPRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRAARVSELEDQIKKIEDDHEIHVATFKEQIANLSREVEQCRTEMGWWRDRSHALE |
| BZIP domain-containing protein | E | 98 | Aspergillus Nidulans Fgsc A4 , Emericella Nidulans (Strain Fgsc A4 / Atcc 38163 / Cbs 112.46 / Nrrl 194 / M139) , Synthetic Construct | GSVTSKEWIIPPRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRAARVSELEDQIKKIEDDHEIHVATFKEQIANLSREVEQCRTEMGWWRDRSHALE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-06 Deposition Author(s): Groll, M. , Huber, E.M.