Virtual screening approach leading to the identification of a novel and tractable series of pseudomonas aeruginosa elastase inhibitors
PDB DOI: 10.2210/pdb7ajr/pdb
Classification: HYDROLASE Organism(s): Pseudomonas Aeruginosa
Deposited: 2020-09-29 Deposition Author(s): Behria, L. , Bodnarchuk, M.S. , Castandet, J. , Davies, D.T. , Everett, M. , Forrest, A.K. , Jones, M.W. , Karunakar, P. , Kotha, V. , Leiris, S. , Lemonnier, M. , Martha, S.K. , Mullins, T.M.G. , Pallin, T.D. , Parusharamulu, B. , Pothukanuri, S. , Pottabathini, N. , Ramula, R. , Sprinsky, N. , Sutton, J.M.
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Virtual screening approach leading to the identification of a novel and tractable series of pseudomonas aeruginosa elastase inhibitors
Behria, L. , Bodnarchuk, M.S. , Castandet, J. , Davies, D.T. , Everett, M. , Forrest, A.K. , Jones, M.W. , Karunakar, P. , Kotha, V. , Leiris, S. , Lemonnier, M. , Martha, S.K. , Mullins, T.M.G. , Pallin, T.D. , Parusharamulu, B. , Pothukanuri, S. , Pottabathini, N. , Ramula, R. , Sprinsky, N. , Sutton, J.M.
Primary Citation of Related Structures: 7AJR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Keratinase KP2 | AAA | 301 | Pseudomonas Aeruginosa | AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-29 Deposition Author(s): Behria, L. , Bodnarchuk, M.S. , Castandet, J. , Davies, D.T. , Everett, M. , Forrest, A.K. , Jones, M.W. , Karunakar, P. , Kotha, V. , Leiris, S. , Lemonnier, M. , Martha, S.K. , Mullins, T.M.G. , Pallin, T.D. , Parusharamulu, B. , Pothukanuri, S. , Pottabathini, N. , Ramula, R. , Sprinsky, N. , Sutton, J.M.