Structural comparison of cellular retinoic acid binding protein i and ii in the presence and absence of natural and synthetic ligands
PDB DOI: 10.2210/pdb7a9y/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2020-09-02 Deposition Author(s): Cornish, K.A.S. , Pohl, E. , Tomlinson, C.W.E.
Structural comparison of cellular retinoic acid binding protein i and ii in the presence and absence of natural and synthetic ligands
Cornish, K.A.S. , Pohl, E. , Tomlinson, C.W.E.
Primary Citation of Related Structures: 7A9Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cellular retinoic acid-binding protein 1 | BBB | 137 | Homo Sapiens | MPNFAGTWKMRSSENFDELLKALGVNAMCRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
| Cellular retinoic acid-binding protein 1 | AAA | 137 | Homo Sapiens | MPNFAGTWKMRSSENFDELLKALGVNAMCRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-02 Deposition Author(s): Cornish, K.A.S. , Pohl, E. , Tomlinson, C.W.E.