Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp
PDB DOI: 10.2210/pdb7a99/pdb
Classification: TRANSPORT PROTEIN Organism(s): Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099)
Deposited: 2020-09-01 Deposition Author(s): Balasco, N. , Ruggiero, A. , Smaldone, G. , Vitagliano, L.
Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp
Balasco, N. , Ruggiero, A. , Smaldone, G. , Vitagliano, L.
Primary Citation of Related Structures: 7A99
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein | A | 136 | Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) | AIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTWDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGGGGSGEQYGIAVRKEDTDLLEFINSVLRELKKLEHHHHHH |
| Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein | B | 136 | Thermotoga Maritima , Thermotoga Maritima (Strain Atcc 43589 / Msb8 / Dsm 3109 / Jcm 10099) | AIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTWDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGGGGSGEQYGIAVRKEDTDLLEFINSVLRELKKLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-01 Deposition Author(s): Balasco, N. , Ruggiero, A. , Smaldone, G. , Vitagliano, L.