7A00
Crystal structure of shank1 pdz in complex with l6f mutant of the c-terminal hexapeptide from gkap
PDB DOI: 10.2210/pdb7a00/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-08-05 Deposition Author(s): Edwards, T.A. , Fruzsina, H. , Hetherington, K. , Wilson, A.J. , Zsofia, H.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.78 Å
Crystal structure of shank1 pdz in complex with l6f mutant of the c-terminal hexapeptide from gkap
Edwards, T.A. , Fruzsina, H. , Hetherington, K. , Wilson, A.J. , Zsofia, H.
Primary Citation of Related Structures: 7A00
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SH3 and multiple ankyrin repeat domains protein 1 | A | 112 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDM |
| SH3 and multiple ankyrin repeat domains protein 1 | B | 112 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDM |
| L6F mutant of C-terminal hexapeptide from Guanylate kinase-associated protein | C | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XEAQTRF |
| L6F mutant of C-terminal hexapeptide from Guanylate kinase-associated protein | D | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XEAQTRF |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-05 Deposition Author(s): Edwards, T.A. , Fruzsina, H. , Hetherington, K. , Wilson, A.J. , Zsofia, H.