Structure of the trem2 transmembrane helix in complex with dap12 in dpc micelles
PDB DOI: 10.2210/pdb6z0i/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 2020-05-08 Deposition Author(s): Brunner, B. , Haass, C. , Hagn, F. , Schlepkow, K. , Steiner, A. , Steiner, H.
Method: SOLUTION NMR Resolution: N.A.
Structure of the trem2 transmembrane helix in complex with dap12 in dpc micelles
Brunner, B. , Haass, C. , Hagn, F. , Schlepkow, K. , Steiner, A. , Steiner, H.
Primary Citation of Related Structures: 6Z0I
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Triggering receptor expressed on myeloid cells 2 | A | 49 | Homo Sapiens | GSGRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTH |
Method: SOLUTION NMR
Deposited Date: 2020-05-08 Deposition Author(s): Brunner, B. , Haass, C. , Hagn, F. , Schlepkow, K. , Steiner, A. , Steiner, H.