Solution nmr structure of the c-terminal arm of rsv nucleoprotein
PDB DOI: 10.2210/pdb6yjl/pdb
Classification: VIRAL PROTEIN Organism(s): Human Respiratory Syncytial Virus A (Strain A2)
Deposited: 2020-04-03 Deposition Author(s): Cardone, C. , Eleouet, J.-F. , Galloux, M. , Sizun, C.
Solution nmr structure of the c-terminal arm of rsv nucleoprotein
Cardone, C. , Eleouet, J.-F. , Galloux, M. , Sizun, C.
Primary Citation of Related Structures: 6YJL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nucleoprotein | A | 33 | Human Respiratory Syncytial Virus A (Strain A2) | GSGVINYSVLDLTAEELEAIKHQLNPKDNDVEL |
Method: SOLUTION NMR
Deposited Date: 2020-04-03 Deposition Author(s): Cardone, C. , Eleouet, J.-F. , Galloux, M. , Sizun, C.