Crystal structure of cd137 in complex with the cyclic peptide bcy10916
PDB DOI: 10.2210/pdb6y8k/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-03-05 Deposition Author(s): Battula, S. , Beswick, P. , Chen, L. , Dods, R. , Haines, E. , Harrison, H. , Hurov, K. , Keen, N. , Kleyman, M. , Kristensson, J. , Kublin, J. , Lahdenranta, J. , Ma, J. , Mcdonnell, K. , Mudd, G. , Repash, E. , Upadhyaya, P. , Van Rietschoten, K.
Crystal structure of cd137 in complex with the cyclic peptide bcy10916
Battula, S. , Beswick, P. , Chen, L. , Dods, R. , Haines, E. , Harrison, H. , Hurov, K. , Keen, N. , Kleyman, M. , Kristensson, J. , Kublin, J. , Lahdenranta, J. , Ma, J. , Mcdonnell, K. , Mudd, G. , Repash, E. , Upadhyaya, P. , Van Rietschoten, K.
Primary Citation of Related Structures: 6Y8K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tumor necrosis factor receptor superfamily member 9 | AAA | 165 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MVSAIVLYVLLAAAAHSAFALQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCSFGTFNDQKRGICRPWTDCSLDGKSVLVDGTKERDVVCGPGSHHHHHH |
BCY10916 | PPP | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | CIEEGQYCFADPYLC |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-03-05 Deposition Author(s): Battula, S. , Beswick, P. , Chen, L. , Dods, R. , Haines, E. , Harrison, H. , Hurov, K. , Keen, N. , Kleyman, M. , Kristensson, J. , Kublin, J. , Lahdenranta, J. , Ma, J. , Mcdonnell, K. , Mudd, G. , Repash, E. , Upadhyaya, P. , Van Rietschoten, K.