P38a bound with mcp-81
PDB DOI: 10.2210/pdb6y6v/pdb
Classification: TRANSFERASE Organism(s): Mus Musculus
Deposited: 2020-02-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Knapp, S. , Roehm, S. , Schroeder, M. , Structural Genomics Consortium (Sgc)
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
P38a bound with mcp-81
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Knapp, S. , Roehm, S. , Schroeder, M. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 6Y6V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitogen-activated protein kinase 14 | A | 361 | Mus Musculus | GMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-02-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Knapp, S. , Roehm, S. , Schroeder, M. , Structural Genomics Consortium (Sgc)