Nmr solution structure of the hazelnut allergen cor a 1.0403
PDB DOI: 10.2210/pdb6y3k/pdb
Classification: ALLERGEN Organism(s): Corylus Avellana
Deposited: 2020-02-18 Deposition Author(s): Fuehrer, S. , Hofer, F. , Kamenik, A.S. , Liedl, K.R. , Nothegger, B. , Reider, N. , Tollinger, M. , Zeindl, R.
Nmr solution structure of the hazelnut allergen cor a 1.0403
Fuehrer, S. , Hofer, F. , Kamenik, A.S. , Liedl, K.R. , Nothegger, B. , Reider, N. , Tollinger, M. , Zeindl, R.
Primary Citation of Related Structures: 6Y3K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Major allergen variant Cor a 1.0403 | A | 160 | Corylus Avellana | GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC |
Method: SOLUTION NMR
Deposited Date: 2020-02-18 Deposition Author(s): Fuehrer, S. , Hofer, F. , Kamenik, A.S. , Liedl, K.R. , Nothegger, B. , Reider, N. , Tollinger, M. , Zeindl, R.