Crystal structure of the d/d domain of pka from s. cerevisiae
PDB DOI: 10.2210/pdb6xqk/pdb
Classification: SIGNALING PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2020-07-09 Deposition Author(s): Buschiazzo, A. , Gonzalez Bardeci, N. , Larrieux, N. , Trajtenberg, F.
Method: X-RAY DIFFRACTION Resolution: 2.56 Å
Crystal structure of the d/d domain of pka from s. cerevisiae
Buschiazzo, A. , Gonzalez Bardeci, N. , Larrieux, N. , Trajtenberg, F.
Primary Citation of Related Structures: 6XQK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase regulatory subunit | A | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
| cAMP-dependent protein kinase regulatory subunit | B | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
| cAMP-dependent protein kinase regulatory subunit | C | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
| cAMP-dependent protein kinase regulatory subunit | D | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
| cAMP-dependent protein kinase regulatory subunit | E | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
| cAMP-dependent protein kinase regulatory subunit | F | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
| cAMP-dependent protein kinase regulatory subunit | G | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
| cAMP-dependent protein kinase regulatory subunit | H | 51 | Saccharomyces Cerevisiae | AMVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAR |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-07-09 Deposition Author(s): Buschiazzo, A. , Gonzalez Bardeci, N. , Larrieux, N. , Trajtenberg, F.