Crystal structure of the type iii secretion system pilotin-secretin complex invh-invg
PDB DOI: 10.2210/pdb6xfk/pdb
Classification: PROTEIN TRANSPORT Organism(s): Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) , Synthetic Construct
Deposited: 2020-06-15 Deposition Author(s): Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of the type iii secretion system pilotin-secretin complex invh-invg
Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.
Primary Citation of Related Structures: 6XFK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Type 3 secretion system pilotin | A | 68 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) , Synthetic Construct | GSHMFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL |
| Type 3 secretion system secretin | B | 16 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) , Synthetic Construct | DDKLQKWVRVYLDRGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-06-15 Deposition Author(s): Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.