6XFK
Crystal structure of the type iii secretion system pilotin-secretin complex invh-invg
PDB DOI: 10.2210/pdb6xfk/pdb
Classification: PROTEIN TRANSPORT Organism(s): Scytodes Thoracica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-06-15 Deposition Author(s): Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of the type iii secretion system pilotin-secretin complex invh-invg
Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.
Primary Citation of Related Structures: 6XFK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Type 3 secretion system pilotin | A | 68 | Scytodes Thoracica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLAAHERLQAL |
| Type 3 secretion system secretin | B | 16 | Scytodes Thoracica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DDKLQKWVRVYLDRGQ |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-06-15 Deposition Author(s): Heinkel, F. , Majewski, D.D. , Mcintosh, L.P. , Okon, M. , Robb, C.S. , Strynadka, N.C.J. , Vuckovic, M.