Human cyclophilin a bound to a series of acylcic and macrocyclic inhibitors
PDB DOI: 10.2210/pdb6x3r/pdb
Classification: ISOMERASE/ISOMERASE INHIBITOR Organism(s): Homo Sapiens
Deposited: 2020-05-21 Deposition Author(s): Appleby, T.C. , Paulsen, J.L. , Schmitz, U. , Shivakumar, D.
Human cyclophilin a bound to a series of acylcic and macrocyclic inhibitors
Appleby, T.C. , Paulsen, J.L. , Schmitz, U. , Shivakumar, D.
Primary Citation of Related Structures: 6X3R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase A | A | 167 | Homo Sapiens | GHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-05-21 Deposition Author(s): Appleby, T.C. , Paulsen, J.L. , Schmitz, U. , Shivakumar, D.