Solution structure of the seed peptide c2 (vbp-1) from pumpkin
PDB DOI: 10.2210/pdb6wql/pdb
Classification: PLANT PROTEIN Organism(s): N.A.
Deposited: 2020-04-29 Deposition Author(s): Payne, C.P. , Rosengren, K.J.
Solution structure of the seed peptide c2 (vbp-1) from pumpkin
Primary Citation of Related Structures: 6WQL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Seed peptide C2 (VBP-1) | A | 49 | N.A. | QRGSPRAEYEVCRLRCQVAERGVEQQRKCEQVCEERLREREQGRGEDVD |
Method: SOLUTION NMR
Deposited Date: 2020-04-29 Deposition Author(s): Payne, C.P. , Rosengren, K.J.