6WA1
Dimeric form of the trans-stabilized hemolysin ii c-terminal domain
PDB DOI: 10.2210/pdb6wa1/pdb
Classification: TOXIN Organism(s): Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711)
Deposited: 2020-03-24 Deposition Author(s): Alexandrescu, A.T. , Kaplan, A.R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Dimeric form of the trans-stabilized hemolysin ii c-terminal domain
Alexandrescu, A.T. , Kaplan, A.R.
Primary Citation of Related Structures: 6WA1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hemolysin II | A | 94 | Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711) | DNQKALEEQMNSINSVNDKLNKGKGKLSLSMNGNQLKATSSNAGYGISYEDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI |
| Hemolysin II | B | 94 | Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711) | DNQKALEEQMNSINSVNDKLNKGKGKLSLSMNGNQLKATSSNAGYGISYEDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2020-03-24 Deposition Author(s): Alexandrescu, A.T. , Kaplan, A.R.