De novo designed receptor transmembrane domains enhance car-t cytotoxicity and attenuate cytokine release
PDB DOI: 10.2210/pdb6w9z/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Synthetic Construct
Deposited: 2020-03-24 Deposition Author(s): Call, M.E. , Call, M.J. , Chandler, N.J. , Nguyen, J.V. , Trenker, R.
De novo designed receptor transmembrane domains enhance car-t cytotoxicity and attenuate cytokine release
Call, M.E. , Call, M.J. , Chandler, N.J. , Nguyen, J.V. , Trenker, R.
Primary Citation of Related Structures: 6W9Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| De novo designed receptor transmembrane domain ProMP C2.1 | A | 30 | Synthetic Construct | EPELTVALILGIFLGTFIAFWVVYLLRRLC |
| De novo designed receptor transmembrane domain ProMP C2.1 | B | 30 | Synthetic Construct | EPELTVALILGIFLGTFIAFWVVYLLRRLC |
| De novo designed receptor transmembrane domain ProMP C2.1 | C | 30 | Synthetic Construct | EPELTVALILGIFLGTFIAFWVVYLLRRLC |
| De novo designed receptor transmembrane domain ProMP C2.1 | D | 30 | Synthetic Construct | EPELTVALILGIFLGTFIAFWVVYLLRRLC |
| De novo designed receptor transmembrane domain ProMP C2.1 | E | 30 | Synthetic Construct | EPELTVALILGIFLGTFIAFWVVYLLRRLC |
| De novo designed receptor transmembrane domain ProMP C2.1 | F | 30 | Synthetic Construct | EPELTVALILGIFLGTFIAFWVVYLLRRLC |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-03-24 Deposition Author(s): Call, M.E. , Call, M.J. , Chandler, N.J. , Nguyen, J.V. , Trenker, R.