Solution structure of antifungal plant defensin pvd1
PDB DOI: 10.2210/pdb6vpn/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Phaseolus Vulgaris
Deposited: 2020-02-03 Deposition Author(s): Harvey, P.J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of antifungal plant defensin pvd1
Primary Citation of Related Structures: 6VPN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Knot1 domain-containing protein | A | 47 | Phaseolus Vulgaris | KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC |
Method: SOLUTION NMR
Deposited Date: 2020-02-03 Deposition Author(s): Harvey, P.J.