Crystal structure of dehaloperoxidase b in complex with cofactor iron(iii) deuteroporphyrin ix and substrate 4-nitrophenol
PDB DOI: 10.2210/pdb6vdt/pdb
Classification: OXIDOREDUCTASE Organism(s): Amphitrite Ornata
Deposited: 2019-12-27 Deposition Author(s): De Serrano, V.S. , Ghiladi, R.A. , Malewschik, T. , Mcguire, A.
Crystal structure of dehaloperoxidase b in complex with cofactor iron(iii) deuteroporphyrin ix and substrate 4-nitrophenol
De Serrano, V.S. , Ghiladi, R.A. , Malewschik, T. , Mcguire, A.
Primary Citation of Related Structures: 6VDT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dehaloperoxidase B | A | 137 | Amphitrite Ornata | GFKQDIATLRGDLRTYAQDIFLAFLNKYPDEKRNFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDASTLVQMKQHSGLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK |
| Dehaloperoxidase B | B | 137 | Amphitrite Ornata | GFKQDIATLRGDLRTYAQDIFLAFLNKYPDEKRNFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDASTLVQMKQHSGLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-27 Deposition Author(s): De Serrano, V.S. , Ghiladi, R.A. , Malewschik, T. , Mcguire, A.