6VBX
Crystal structure of mcl-1 in complex with 138e12 peptide, lys-covalent antagonist
PDB DOI: 10.2210/pdb6vbx/pdb
Classification: APOPTOSIS Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-12-19 Deposition Author(s): Assar, Z. , Kenjic, N. , Pellecchia, M. , Perry, J.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of mcl-1 in complex with 138e12 peptide, lys-covalent antagonist
Assar, Z. , Kenjic, N. , Pellecchia, M. , Perry, J.J.
Primary Citation of Related Structures: 6VBX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Induced myeloid leukemia cell differentiation protein Mcl-1 | A | 156 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVED |
| Synthetic peptide | B | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XIAEQLRRIGDRF |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-19 Deposition Author(s): Assar, Z. , Kenjic, N. , Pellecchia, M. , Perry, J.J.