Cftr associated ligand (cal) pdz domain bound to peptidomimetic lycalac
PDB DOI: 10.2210/pdb6v84/pdb
Classification: PEPTIDE BINDING PROTEIN/INHIBITOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2019-12-10 Deposition Author(s): Gill, N.P. , Madden, D.R.
Cftr associated ligand (cal) pdz domain bound to peptidomimetic lycalac
Primary Citation of Related Structures: 6V84
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
LyCALAc | C | 10 | Homo Sapiens , Synthetic Construct | ANSRLPTSKI |
LyCALAc | D | 10 | Homo Sapiens , Synthetic Construct | ANSRLPTSKI |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-10 Deposition Author(s): Gill, N.P. , Madden, D.R.