6V67
Apo structure of the de novo pd-1 binding miniprotein gr918.2
PDB DOI: 10.2210/pdb6v67/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2019-12-04 Deposition Author(s): Baker, D. , Bick, M.J. , Bryan, C.M. , Dimaio, F. , Kang, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.07 Å
Apo structure of the de novo pd-1 binding miniprotein gr918.2
Baker, D. , Bick, M.J. , Bryan, C.M. , Dimaio, F. , Kang, A.
Primary Citation of Related Structures: 6V67
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PD-1 Binding Miniprotein GR918.2 | A | 43 | Synthetic Construct | GSCFCVCITGPQWDYRYGNKEQCKKFLTECEQKNPGAEVEIQC |
| PD-1 Binding Miniprotein GR918.2 | B | 43 | Synthetic Construct | GSCFCVCITGPQWDYRYGNKEQCKKFLTECEQKNPGAEVEIQC |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-04 Deposition Author(s): Baker, D. , Bick, M.J. , Bryan, C.M. , Dimaio, F. , Kang, A.