Crystal structure of cdy1 chromodomain bound to h3k9me3
PDB DOI: 10.2210/pdb6v41/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2019-11-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R.
Method: X-RAY DIFFRACTION Resolution: 1.603 Å
Crystal structure of cdy1 chromodomain bound to h3k9me3
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R.
Primary Citation of Related Structures: 6V41
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Testis-specific chromodomain protein Y 1 | AAA | 63 | Homo Sapiens , Synthetic Construct | GASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQK |
| Histone H3.1 Peptide | QQQ | 15 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-27 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R.