Crystal structure of chromodomain of cbx7 mutant v13a in complex with inhibitor unc3866
PDB DOI: 10.2210/pdb6v2r/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2019-11-25 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.
Crystal structure of chromodomain of cbx7 mutant v13a in complex with inhibitor unc3866
Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.
Primary Citation of Related Structures: 6V2R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromobox protein homolog 7 | A | 56 | Homo Sapiens , Synthetic Construct | GEQVFAAESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE |
UNC3866 | B | 6 | Homo Sapiens , Synthetic Construct | XFALXX |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-25 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.