The se-met structure of the vibrio vulnificus toxr periplasmic domain
PDB DOI: 10.2210/pdb6uue/pdb
Classification: DNA BINDING PROTEIN Organism(s): Vibrio Vulnificus
Deposited: 2019-10-30 Deposition Author(s): Kull, F.J. , Midgett, C.R. , Swindell, R.A.
The se-met structure of the vibrio vulnificus toxr periplasmic domain
Kull, F.J. , Midgett, C.R. , Swindell, R.A.
Primary Citation of Related Structures: 6UUE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional activator ToxR | A | 104 | Vibrio Vulnificus | MAHHHHHHTNPSESKFRLLENVNGVEVLTPLNHPPLQAWMPSIRQCVNKYAETHTGDSAPVKVIATGGQGNQLILNYIHTLPHSNENVTLRIFSEQNDLGSICK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-10-30 Deposition Author(s): Kull, F.J. , Midgett, C.R. , Swindell, R.A.