Crystal structure analysis of dna-bcl11a znf domain complex
PDB DOI: 10.2210/pdb6u9q/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-09-09 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.
Crystal structure analysis of dna-bcl11a znf domain complex
Primary Citation of Related Structures: 6U9Q
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
B-cell lymphoma/leukemia 11A | A | 110 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPHMPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-09-09 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.