Solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae
PDB DOI: 10.2210/pdb6u6r/pdb
Classification: CELL CYCLE Organism(s): Streptococcus Intermedius Sk54 = Atcc 27335
Deposited: 2019-08-30 Deposition Author(s): Cai, M. , Clore, M. , Shen, Y.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cell division topological specificity factor | A | 65 | Streptococcus Intermedius Sk54 = Atcc 27335 | AQEGQTPDYLPTLRKELMEVLSKYVNVSLDNIRISQEKQDGMDVLELNITLPEQKKVLEHHHHHH |
Cell division topological specificity factor | B | 65 | Streptococcus Intermedius Sk54 = Atcc 27335 | AQEGQTPDYLPTLRKELMEVLSKYVNVSLDNIRISQEKQDGMDVLELNITLPEQKKVLEHHHHHH |
Method: SOLID-STATE NMR