Crystal structure of human fkbp51 fk1 domain a19t mutant in complex with 2-pyridone
PDB DOI: 10.2210/pdb6tx4/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens
Deposited: 2020-01-13 Deposition Author(s): Draxler, S.W. , Fiegen, D.
Crystal structure of human fkbp51 fk1 domain a19t mutant in complex with 2-pyridone
Primary Citation of Related Structures: 6TX4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase FKBP5 | A | 128 | Homo Sapiens | GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-01-13 Deposition Author(s): Draxler, S.W. , Fiegen, D.