Crystal structure of receiver domain from hybrid histidine kinase ccka
PDB DOI: 10.2210/pdb6tne/pdb
Classification: TRANSFERASE Organism(s): Caulobacter Vibrioides
Deposited: 2019-12-06 Deposition Author(s): Bruederlin, M. , Dubey, B.N. , Schirmer, T.
Crystal structure of receiver domain from hybrid histidine kinase ccka
Bruederlin, M. , Dubey, B.N. , Schirmer, T.
Primary Citation of Related Structures: 6TNE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histidine kinase | A | 120 | Caulobacter Vibrioides | GRILFVEDEDAVRSVAARLLRARGYEVLEAADGEEALIIAEENAGTIDLLISDVIMPGIDGPTLLKKARGYLGTAPVMFISGYAEAEFSDLLEGETGVTFLPKPIDIKTLAERVKQQLQA |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-06 Deposition Author(s): Bruederlin, M. , Dubey, B.N. , Schirmer, T.