Solution structure of rfah c-terminal domain from vibrio cholerae
PDB DOI: 10.2210/pdb6tf4/pdb
Classification: TRANSCRIPTION Organism(s): Puumala Virus (Strain P360)
Deposited: 2019-11-13 Deposition Author(s): Knauer, S.H. , Schweimer, K. , Zuber, P.K.
Solution structure of rfah c-terminal domain from vibrio cholerae
Knauer, S.H. , Schweimer, K. , Zuber, P.K.
Primary Citation of Related Structures: 6TF4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription/translation regulatory transformer protein RfaH | A | 67 | Puumala Virus (Strain P360) | GAMGEQLKHATKQLPEKGQTVRVARGQFAGIEAIYLEPDGDTRSIMLVKMISQQVPMSIENTDWEVT |
Method: SOLUTION NMR
Deposited Date: 2019-11-13 Deposition Author(s): Knauer, S.H. , Schweimer, K. , Zuber, P.K.