X-ray structure of the c-terminal domain of s. aureus hibernating promoting factor (ctd-sahpf)
PDB DOI: 10.2210/pdb6t7o/pdb
Classification: RIBOSOMAL PROTEIN Organism(s): Staphylococcus Aureus (Strain Nctc 8325)
Deposited: 2019-10-22 Deposition Author(s): Ayupov, R.K. , Fatkhullin, B.F. , Gabdulkhakov, A.G. , Khusainov, I.S. , Tishchenko, S.V. , Validov, S.Z. , Yusupov, M.M.
X-ray structure of the c-terminal domain of s. aureus hibernating promoting factor (ctd-sahpf)
Ayupov, R.K. , Fatkhullin, B.F. , Gabdulkhakov, A.G. , Khusainov, I.S. , Tishchenko, S.V. , Validov, S.Z. , Yusupov, M.M.
Primary Citation of Related Structures: 6T7O
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ribosome hibernation promotion factor | A | 67 | Staphylococcus Aureus (Strain Nctc 8325) | MIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTSEQHHHHHH |
Ribosome hibernation promotion factor | B | 67 | Staphylococcus Aureus (Strain Nctc 8325) | MIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTSEQHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-10-22 Deposition Author(s): Ayupov, R.K. , Fatkhullin, B.F. , Gabdulkhakov, A.G. , Khusainov, I.S. , Tishchenko, S.V. , Validov, S.Z. , Yusupov, M.M.