Crystal structure of the domain-swapped n-lobe dimer of drosophila arc 2
PDB DOI: 10.2210/pdb6sib/pdb
Classification: VIRUS LIKE PARTICLE Organism(s): Drosophila Melanogaster
Deposited: 2019-08-09 Deposition Author(s): Hallin, E.I. , Kursula, P.
Crystal structure of the domain-swapped n-lobe dimer of drosophila arc 2
Primary Citation of Related Structures: 6SIB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Activity-regulated cytoskeleton associated protein 2 | A | 73 | Drosophila Melanogaster | SRFSGQRDHDAVDEFINAVETYKEVEGISDKDALKGLPLLFKSIAVVWWKGVRRDAKTWSDALQLLRDHFSPT |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-08-09 Deposition Author(s): Hallin, E.I. , Kursula, P.