Solution structure of protein arr_cled in complex with c-di-gmp
PDB DOI: 10.2210/pdb6sft/pdb
Classification: SIGNALING PROTEIN Organism(s): Caulobacter Vibrioides (Strain Na1000 / Cb15N)
Deposited: 2019-08-02 Deposition Author(s): Grzesiek, S. , Habazettl, J. , Hee, C.S. , Jenal, U. , Schirmer, T.
Solution structure of protein arr_cled in complex with c-di-gmp
Grzesiek, S. , Habazettl, J. , Hee, C.S. , Jenal, U. , Schirmer, T.
Primary Citation of Related Structures: 6SFT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Two-component receiver protein CleD | A | 36 | Caulobacter Vibrioides (Strain Na1000 / Cb15N) | SKPREWVEAVAYVGPDRRRFNSADYKGPRKRKADAS |
Method: SOLUTION NMR
Deposited Date: 2019-08-02 Deposition Author(s): Grzesiek, S. , Habazettl, J. , Hee, C.S. , Jenal, U. , Schirmer, T.