N-terminal sh3 domain of grb2 protein
PDB DOI: 10.2210/pdb6sdf/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2019-07-26 Deposition Author(s): Bezprozvanny, I.B. , Bolgov, A.A. , Kim, M. , Korban, S.A. , Luzik, D.A. , Rogacheva, O.N. , Skrynnikov, N.R. , Zhemkov, V.A.
N-terminal sh3 domain of grb2 protein
Bezprozvanny, I.B. , Bolgov, A.A. , Kim, M. , Korban, S.A. , Luzik, D.A. , Rogacheva, O.N. , Skrynnikov, N.R. , Zhemkov, V.A.
Primary Citation of Related Structures: 6SDF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Growth factor receptor-bound protein 2 | A | 61 | Salmonella Enterica | GSEAIAKYDFKATADDELSFKRGDILKVLNEESDQNWYKAELNGKDGFIPKNYIEMKPHPG |
Growth factor receptor-bound protein 2 | B | 61 | Salmonella Enterica | GSEAIAKYDFKATADDELSFKRGDILKVLNEESDQNWYKAELNGKDGFIPKNYIEMKPHPG |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-07-26 Deposition Author(s): Bezprozvanny, I.B. , Bolgov, A.A. , Kim, M. , Korban, S.A. , Luzik, D.A. , Rogacheva, O.N. , Skrynnikov, N.R. , Zhemkov, V.A.