Crystal structure of group a of usutu virus envelope protein domain iii
PDB DOI: 10.2210/pdb6s92/pdb
Classification: VIRAL PROTEIN Organism(s): Usutu Virus
Deposited: 2019-07-11 Deposition Author(s): Schoenenwald, A.K.J. , Skern, T.
Crystal structure of group a of usutu virus envelope protein domain iii
Schoenenwald, A.K.J. , Skern, T.
Primary Citation of Related Structures: 6S92
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Genome polyprotein | A | 103 | Usutu Virus | GTTYGMCTEKFSFAKNPADTGHGTVVLELQYTGSDGPCKIPISIVASLSDLTPIGRMVTANPYVASSEANAKVLVEMEPPFGDSYIVVGRGDKQINHHWHKAG |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-07-11 Deposition Author(s): Schoenenwald, A.K.J. , Skern, T.