Cereblon isoform 4 from magnetospirillum gryphiswaldense in complex with hydrolysis product of compound 4b
PDB DOI: 10.2210/pdb6r0v/pdb
Classification: SIGNALING PROTEIN Organism(s): Magnetospirillum Gryphiswaldense Msr-1
Deposited: 2019-03-13 Deposition Author(s): Hartmann, M.D. , Heim, C.
Cereblon isoform 4 from magnetospirillum gryphiswaldense in complex with hydrolysis product of compound 4b
Primary Citation of Related Structures: 6R0V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cereblon isoform 4 | A | 125 | Magnetospirillum Gryphiswaldense Msr-1 | AMPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPAD |
| Cereblon isoform 4 | B | 125 | Magnetospirillum Gryphiswaldense Msr-1 | AMPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPAD |
| Cereblon isoform 4 | C | 125 | Magnetospirillum Gryphiswaldense Msr-1 | AMPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPAD |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-03-13 Deposition Author(s): Hartmann, M.D. , Heim, C.