Solid-state nmr structure of outer membrane protein alkl in dmpc lipid bilayers
PDB DOI: 10.2210/pdb6qwr/pdb
Classification: MEMBRANE PROTEIN Organism(s): Pseudomonas Oleovorans
Deposited: 2019-03-06 Deposition Author(s): Andreas, L.B. , Pintacuda, G. , Schubeis, T.
Solid-state nmr structure of outer membrane protein alkl in dmpc lipid bilayers
Andreas, L.B. , Pintacuda, G. , Schubeis, T.
Primary Citation of Related Structures: 6QWR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Outer membrane protein AlkL | A | 219 | Pseudomonas Oleovorans | MNENYPAKSAGYNQGDWVASFNFSKVYVGEELGDLNVGGGALPNADVSIGNDTTLTFDIAYFVSSNIAVDFFVGVPARAKFQGEKSISSLGRVSEVDYGPAILSLQYHYDSFERLYPYVGVGVGRVLFFDKTDGALSSFDIKDKWAPAFQVGLRYDLGNSWMLNSDVRYIPFKTDVTGTLGPVPVSTKIEVDPFILSLGASYVFKLAAALEHHHHHHHH |
Method: SOLID-STATE NMR
Deposited Date: 2019-03-06 Deposition Author(s): Andreas, L.B. , Pintacuda, G. , Schubeis, T.